PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015876734.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family ARR-B
Protein Properties Length: 702aa    MW: 77699.5 Da    PI: 8.1035
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015876734.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like65.31.1e-20339391255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      r++W+peLH +F  av+ L G +kA Pk ilelm+ + +tl +v+SHLQkY++
  XP_015876734.1 339 SRVVWSPELHLKFTAAVSAL-GDKKARPKPILELMNSPNITLRQVASHLQKYKS 391
                     79******************.9******************************86 PP

2Response_reg46.12.6e-16271331107
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEE.EEESTTTHHHHHHHHHT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpii.vvtahgeeedalealka 92 
                     +l+vd + + ++ l+++le+  + +v++++ ++ al +l+e++  + l++  +++p++d l++l  + +++  +p+i v++++ + ++a +al  
  XP_015876734.1  27 ILVVDNDTVSLMYLASMLEQYSF-KVTTTELASVALSILREQKeqYKLVIANMNLPDIDNLAFLHLLLKKD--IPVIqVMSSERNGNLAGKALAQ 118
                     89*********************.***************777777**********************8877..5555267799999********* PP

                     TESEEEESS--HHHH CS
    Response_reg  93 GakdflsKpfdpeel 107
                     Ga  fl Kp+  e+l
  XP_015876734.1 119 GACYFLQKPICLEDL 133
                     *********998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521724.13E-2023147IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.1E-2123148No hitNo description
SMARTSM004484.8E-1225137IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011027.0326141IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.6E-1327133IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.41E-1628134No hitNo description
Gene3DG3DSA:1.10.10.602.8E-22336396IPR009057Homeodomain-like
SuperFamilySSF466891.72E-14337395IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-17339391IPR006447Myb domain, plants
PfamPF002494.2E-6340390IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
MCLKMDGNGM NFSVTKIVPK AANGLHILVV DNDTVSLMYL ASMLEQYSFK VTTTELASVA  60
LSILREQKEQ YKLVIANMNL PDIDNLAFLH LLLKKDIPVI QVMSSERNGN LAGKALAQGA  120
CYFLQKPICL EDLKFVWQHM YRKIRKPMKE VCEANIENKM NHGNDSRGIK IKETDNVSRA  180
PEKGNMIKEP GGVSGRPRCQ GIIIKEVNHA TRPPNYEGGK EVGGVSGSAT VCNLDGIQNR  240
YMVTDPNGKK KQFEGHQVSL VNENHVKVVQ NSCTKGSITT EQKKQEGLKT RRQIDDEEQQ  300
QQGKRTKVNS EQKSSQSLKT NEEEGERKDD SSSSNEKRSR VVWSPELHLK FTAAVSALGD  360
KKARPKPILE LMNSPNITLR QVASHLQKYK SQVQKINETS TTDFLPVSKS TSSYSKAEFP  420
SLLERPSALA SPLGQRSLSF GGRGSTQFTA PKSLAQPGPS LSSVINNHRT SNLNSGQMDI  480
SRTLNLYPTN NNSNEVHIEN HSMLQRSNQI RKTSSFNSNN FVNENMKEIQ PYQIQGSVSQ  540
VSETNLPNLS YVIPEAASPC ISADMSQLLN VPPYVNHAQE FAPDLAAPFN SQNQNQLSAG  600
AMGRTDVLQS QPAQMTLGNA TNIEKSPNDF FGGSQNVDPT PEQVAASGSN QNQSLLDYAN  660
LLKFLEDDLE YNCLDSAPDI GDIDHYCKWL EQTLHGKSKD PQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015876734.10.0PREDICTED: two-component response regulator ARR11 isoform X5
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68210.12e-26pseudo-response regulator 6